Lineage for d7nwlc1 (7nwl C:1142-1236)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762366Domain d7nwlc1: 7nwl C:1142-1236 [406065]
    Other proteins in same PDB: d7nwla1, d7nwla2
    automated match to d1fnha2
    complexed with mn

Details for d7nwlc1

PDB Entry: 7nwl (more details), 3.1 Å

PDB Description: cryo-em structure of human integrin alpha5beta1 (open form) in complex with fibronectin and ts2/16 fv-clasp
PDB Compounds: (C:) Isoform 1 of Fibronectin

SCOPe Domain Sequences for d7nwlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nwlc1 b.1.2.0 (C:1142-1236) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc
tfdnlspgleynvsvytvkddkesvpisdtiipav

SCOPe Domain Coordinates for d7nwlc1:

Click to download the PDB-style file with coordinates for d7nwlc1.
(The format of our PDB-style files is described here.)

Timeline for d7nwlc1: