Lineage for d7nkgd2 (7nkg D:288-569)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332848Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2332849Protein automated matches [227075] (5 species)
    not a true protein
  7. 2332862Species Methermicoccus shengliensis [TaxId:1122233] [405829] (1 PDB entry)
  8. 2332864Domain d7nkgd2: 7nkg D:288-569 [406006]
    Other proteins in same PDB: d7nkga1, d7nkgb1, d7nkgb2, d7nkgc_, d7nkgd1, d7nkge1, d7nkge2, d7nkgf_, d7nkgg1, d7nkgh1, d7nkgh2, d7nkgi_, d7nkgj1, d7nkgk1, d7nkgk2, d7nkgl_
    automated match to d1e6ya1
    complexed with com, f43, gol, k, so4, tp7

Details for d7nkgd2

PDB Entry: 7nkg (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution
PDB Compounds: (D:) Methyl-coenzyme M reductase alpha subunit

SCOPe Domain Sequences for d7nkgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nkgd2 a.89.1.0 (D:288-569) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
rrargpnepgglqfgyladivqadrvtddkvkaslevvaagamlydqiwlgsymsggvgf
tqyataaytnnilddfsyygyeyavdkyggpaqapatletvkdiatetaiyaieqyeyfp
tlledqfggsqraavvaaaagiatglatgnsqaglsgwylaqyllkeaegrlgffgydlq
dqcgaanvfsyqsdeglplelrgpnypnyamnvghqgeyagiassghigrgdafvvnplv
kvafadpllnfdftqvrkefakgavrefdrcageralilpak

SCOPe Domain Coordinates for d7nkgd2:

Click to download the PDB-style file with coordinates for d7nkgd2.
(The format of our PDB-style files is described here.)

Timeline for d7nkgd2: