Lineage for d7nkgd1 (7nkg D:5-287)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955165Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2955166Protein automated matches [227074] (6 species)
    not a true protein
  7. 2955193Species Methermicoccus shengliensis [TaxId:1122233] [405827] (1 PDB entry)
  8. 2955196Domain d7nkgd1: 7nkg D:5-287 [406005]
    Other proteins in same PDB: d7nkga2, d7nkgb2, d7nkgc_, d7nkgd2, d7nkge2, d7nkgf_, d7nkgg2, d7nkgh2, d7nkgi_, d7nkgj2, d7nkgk2, d7nkgl_
    automated match to d1e6ya2
    complexed with com, f43, gol, k, so4, tp7

Details for d7nkgd1

PDB Entry: 7nkg (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution
PDB Compounds: (D:) Methyl-coenzyme M reductase alpha subunit

SCOPe Domain Sequences for d7nkgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nkgd1 d.58.31.0 (D:5-287) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
dreqlfkkaleikftqewgenkatevstditskkakylrlgtaqsprkrefeqygkeiaa
krglpgydpklhlggiplgqrqitpyvvsstdtlcdgddlhfvnnaamqqmwddirrtvi
vgmdlahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpglvddcyvkvf
tgddeladeidkrflididkqfgeekaaqikaaigkttwqavhvptivvrtcdgattsrw
tamqigmsfiaayrmcageaavadlayaakhaalvgmgdmlpa

SCOPe Domain Coordinates for d7nkgd1:

Click to download the PDB-style file with coordinates for d7nkgd1.
(The format of our PDB-style files is described here.)

Timeline for d7nkgd1: