Lineage for d1a8rk_ (1a8r K:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035940Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1035941Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1035942Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 1035943Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 1035944Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 1035955Domain d1a8rk_: 1a8r K: [40597]
    complexed with gtp; mutant

Details for d1a8rk_

PDB Entry: 1a8r (more details), 2.1 Å

PDB Description: gtp cyclohydrolase i (h112s mutant) in complex with gtp
PDB Compounds: (K:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1a8rk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8rk_ d.96.1.1 (K:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOPe Domain Coordinates for d1a8rk_:

Click to download the PDB-style file with coordinates for d1a8rk_.
(The format of our PDB-style files is described here.)

Timeline for d1a8rk_: