SCOPe 2.08: Domain d7nnye2: 7nny E:144-307

Lineage for d7nnye2 (7nny E:144-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries)

8. Domain d7nnye2: 7nny E:144-307 [405962]
   Other proteins in same PDB: d7nnya3, d7nnyb3, d7nnyc3, d7nnyd3, d7nnye3, d7nnyf3
   automated match to d2i6ua2
   complexed with 1np, po4

Details for d7nnye2

PDB Entry: 7nny, 1.57 Å

PDB Description: crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.

PDB Compounds: (E:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d7nnye2:

Sequence, based on SEQRES records:

>d7nnye2 c.78.1.0 (E:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga
svtvtadahaaaagadvlvtdtwtsmgqendgldrvkpfrpfqlnsrllaladsdaivlh
clpahrgdeitdavmdgpasavwdeaenrlhaqkallvwllers

Sequence, based on observed residues (ATOM records):

>d7nnye2 c.78.1.0 (E:144-307) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
galrglrlsyfgdgannmahslllggvtagihvtvaapegflpdpsvraaaerraqdtga
svtvtadahaaaagadvlvtdtwtgldrvkpfrpfqlnsrllaladsdaivlhclpahrg
deitdavmdgpasavwdeaenrlhaqkallvwllers

Timeline for d7nnye2:

• d7nnye2 first appeared in SCOPe 2.07