Lineage for d7m32a3 (7m32 A:288-440)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457627Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2457640Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 2457641Species Pig (Sus scrofa) [TaxId:9823] [51912] (9 PDB entries)
  8. 2457654Domain d7m32a3: 7m32 A:288-440 [405932]
    Other proteins in same PDB: d7m32a1, d7m32a2, d7m32a4, d7m32a5, d7m32b1, d7m32b2, d7m32b4, d7m32b5, d7m32c1, d7m32c2, d7m32c4, d7m32c5, d7m32d1, d7m32d2, d7m32d4, d7m32d5
    automated match to d1h7xb3
    complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant

Details for d7m32a3

PDB Entry: 7m32 (more details), 1.82 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) c671a mutant soaked with uracil and nadph anaerobically
PDB Compounds: (A:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7m32a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m32a3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d7m32a3:

Click to download the PDB-style file with coordinates for d7m32a3.
(The format of our PDB-style files is described here.)

Timeline for d7m32a3: