SCOPe 2.07: Domain d7n0ik1: 7n0i K:-1-126

Lineage for d7n0ik1 (7n0i K:-1-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d7n0ik1: 7n0i K:-1-126 [405904]
   Other proteins in same PDB: d7n0ia_, d7n0ib_, d7n0ic_, d7n0id_, d7n0ie_, d7n0if_, d7n0ig_, d7n0ih_, d7n0ii2, d7n0ij2, d7n0ik2, d7n0il2
   automated match to d4y5vd_
   complexed with act, mg

Details for d7n0ik1

PDB Entry: 7n0i, 2.2 Å

PDB Description: structure of the sars-cov-2 n protein c-terminal domain bound to single-domain antibody e2

PDB Compounds: (K:) Single-domain antibody E2

SCOPe Domain Sequences for d7n0ik1:

Sequence; same for both SEQRES and ATOM records:

>d7n0ik1 b.1.1.1 (K:-1-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
maevqlqasggglvqaggslrlscaasgrtdstqhmawfrqapgkerefvtaiqwrgggt
sytdsvkgrftisrdnakntvylemnslkpedtavyycatntrwtyfsptvpdrydywgq
gtqvtvss

Timeline for d7n0ik1:

• d7n0ik1 is new in SCOPe 2.07-stable
  
• d7n0ik1 appears in the current release, SCOPe 2.08