Lineage for d1a8rd_ (1a8r D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34770Fold d.96: T-fold [55619] (1 superfamily)
  4. 34771Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
  5. 34772Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 34773Protein GTP cyclohydrolase I [55622] (2 species)
  7. 34774Species Escherichia coli [TaxId:562] [55623] (4 PDB entries)
  8. 34778Domain d1a8rd_: 1a8r D: [40590]

Details for d1a8rd_

PDB Entry: 1a8r (more details), 2.1 Å

PDB Description: gtp cyclohydrolase i (h112s mutant) in complex with gtp

SCOP Domain Sequences for d1a8rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8rd_ d.96.1.1 (D:) GTP cyclohydrolase I {Escherichia coli}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOP Domain Coordinates for d1a8rd_:

Click to download the PDB-style file with coordinates for d1a8rd_.
(The format of our PDB-style files is described here.)

Timeline for d1a8rd_: