SCOPe 2.08: Domain d7nkgl_: 7nkg L:

Lineage for d7nkgl_ (7nkg L:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
   automatically mapped to Pfam PF02240

6. Protein automated matches [320245] (3 species)
   not a true protein

7. Species Methermicoccus shengliensis [TaxId:1122233] [405898] (1 PDB entry)

8. Domain d7nkgl_: 7nkg L: [405899]
   Other proteins in same PDB: d7nkga1, d7nkga2, d7nkgb1, d7nkgb2, d7nkgd1, d7nkgd2, d7nkge1, d7nkge2, d7nkgg1, d7nkgg2, d7nkgh1, d7nkgh2, d7nkgj1, d7nkgj2, d7nkgk1, d7nkgk2
   automated match to d1e6yc_
   complexed with com, f43, gol, k, so4, tp7

Details for d7nkgl_

PDB Entry: 7nkg, 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution

PDB Compounds: (L:) Methyl-coenzyme M reductase gamma subunit

SCOPe Domain Sequences for d7nkgl_:

Sequence; same for both SEQRES and ATOM records:

>d7nkgl_ d.58.31.1 (L:) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
yepqyypgntsvaqnrrkhmsgnveklreisdedltailghrapgsdypsthpplaemge
pdcpireiveptpgaaagdriryvqwtdsmynapatpywrsyyaainhrgvdpgtlsgrq
ivearerdvevygkmsietemtcpalaglrgatvhghscrlqedgvmfdmldrrrleggt
iimdkdqvgvpldrkvdlgkpmseeeaakrttiyrvdnvpfrsdsevvewvqriwelrtr
ygfqpq

Timeline for d7nkgl_:

• d7nkgl_ first appeared in SCOPe 2.07