![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
![]() | Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
![]() | Protein automated matches [227074] (5 species) not a true protein |
![]() | Species Methermicoccus shengliensis [TaxId:1122233] [405827] (1 PDB entry) |
![]() | Domain d7nkgj1: 7nkg J:6-287 [405890] Other proteins in same PDB: d7nkga2, d7nkgb2, d7nkgc_, d7nkgd2, d7nkge2, d7nkgf_, d7nkgg2, d7nkgh2, d7nkgi_, d7nkgj2, d7nkgk2, d7nkgl_ automated match to d1e6ya2 complexed with com, f43, gol, k, so4, tp7 |
PDB Entry: 7nkg (more details), 1.6 Å
SCOPe Domain Sequences for d7nkgj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nkgj1 d.58.31.0 (J:6-287) automated matches {Methermicoccus shengliensis [TaxId: 1122233]} reqlfkkaleikftqewgenkatevstditskkakylrlgtaqsprkrefeqygkeiaak rglpgydpklhlggiplgqrqitpyvvsstdtlcdgddlhfvnnaamqqmwddirrtviv gmdlahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpglvddcyvkvft gddeladeidkrflididkqfgeekaaqikaaigkttwqavhvptivvrtcdgattsrwt amqigmsfiaayrmcageaavadlayaakhaalvgmgdmlpa
Timeline for d7nkgj1: