SCOPe 2.07: Domain d7nkgj1: 7nkg J:6-287

Lineage for d7nkgj1 (7nkg J:6-287)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.0: automated matches [227271] (1 protein)
   not a true family

6. Protein automated matches [227074] (5 species)
   not a true protein

7. Species Methermicoccus shengliensis [TaxId:1122233] [405827] (1 PDB entry)

8. Domain d7nkgj1: 7nkg J:6-287 [405890]
   Other proteins in same PDB: d7nkga2, d7nkgb2, d7nkgc_, d7nkgd2, d7nkge2, d7nkgf_, d7nkgg2, d7nkgh2, d7nkgi_, d7nkgj2, d7nkgk2, d7nkgl_
   automated match to d1e6ya2
   complexed with com, f43, gol, k, so4, tp7

Details for d7nkgj1

PDB Entry: 7nkg, 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution

PDB Compounds: (J:) Methyl-coenzyme M reductase alpha subunit

SCOPe Domain Sequences for d7nkgj1:

Sequence; same for both SEQRES and ATOM records:

>d7nkgj1 d.58.31.0 (J:6-287) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
reqlfkkaleikftqewgenkatevstditskkakylrlgtaqsprkrefeqygkeiaak
rglpgydpklhlggiplgqrqitpyvvsstdtlcdgddlhfvnnaamqqmwddirrtviv
gmdlahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpglvddcyvkvft
gddeladeidkrflididkqfgeekaaqikaaigkttwqavhvptivvrtcdgattsrwt
amqigmsfiaayrmcageaavadlayaakhaalvgmgdmlpa

Timeline for d7nkgj1:

• d7nkgj1 is new in SCOPe 2.07-stable
  
• d7nkgj1 appears in the current release, SCOPe 2.08