Lineage for d1a8rb_ (1a8r B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966181Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2966182Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 2966183Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 2966185Domain d1a8rb_: 1a8r B: [40588]
    complexed with gtp; mutant

Details for d1a8rb_

PDB Entry: 1a8r (more details), 2.1 Å

PDB Description: gtp cyclohydrolase i (h112s mutant) in complex with gtp
PDB Compounds: (B:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1a8rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8rb_ d.96.1.1 (B:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOPe Domain Coordinates for d1a8rb_:

Click to download the PDB-style file with coordinates for d1a8rb_.
(The format of our PDB-style files is described here.)

Timeline for d1a8rb_: