![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
![]() | Family d.95.2.2: Intein endonuclease [55614] (2 proteins) duplication: contains tandem repeat of this fold |
![]() | Protein PI-Pfui intein [55617] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [55618] (1 PDB entry) |
![]() | Domain d1dq3a4: 1dq3 A:227-335 [40586] Other proteins in same PDB: d1dq3a1, d1dq3a2 complexed with zn |
PDB Entry: 1dq3 (more details), 2.1 Å
SCOPe Domain Sequences for d1dq3a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq3a4 d.95.2.2 (A:227-335) PI-Pfui intein {Pyrococcus furiosus [TaxId: 2261]} ippqilkegknavlsfiaglfdaeghvsnkpgielgmvnkrliedvthylnalgikarir eklrkdgidyvlhveeyssllrfyeligknlqneekreklekvlsnhkg
Timeline for d1dq3a4: