Lineage for d1dq3a3 (1dq3 A:129-226)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730086Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 730093Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 730148Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 730149Protein PI-Pfui intein [55617] (1 species)
  7. 730150Species Archaeon Pyrococcus furiosus [TaxId:2261] [55618] (1 PDB entry)
  8. 730151Domain d1dq3a3: 1dq3 A:129-226 [40585]
    Other proteins in same PDB: d1dq3a1, d1dq3a2

Details for d1dq3a3

PDB Entry: 1dq3 (more details), 2.1 Å

PDB Description: crystal structure of an archaeal intein-encoded homing endonuclease pi-pfui
PDB Compounds: (A:) endonuclease

SCOP Domain Sequences for d1dq3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq3a3 d.95.2.2 (A:129-226) PI-Pfui intein {Archaeon Pyrococcus furiosus [TaxId: 2261]}
pdgedykfifdywlagfiagdgcfdkyhshvkgheyiydrlriydyrietfeiindylek
tfgrkysiqkdrniyyidikarnitshylkllegidng

SCOP Domain Coordinates for d1dq3a3:

Click to download the PDB-style file with coordinates for d1dq3a3.
(The format of our PDB-style files is described here.)

Timeline for d1dq3a3: