Lineage for d7nkgb2 (7nkg B:185-433)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332767Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2332828Protein automated matches [315354] (3 species)
    not a true protein
  7. 2332843Species Methermicoccus shengliensis [TaxId:1122233] [405839] (1 PDB entry)
  8. 2332844Domain d7nkgb2: 7nkg B:185-433 [405840]
    Other proteins in same PDB: d7nkga1, d7nkga2, d7nkgb1, d7nkgc_, d7nkgd1, d7nkgd2, d7nkge1, d7nkgf_, d7nkgg1, d7nkgg2, d7nkgh1, d7nkgi_, d7nkgj1, d7nkgj2, d7nkgk1, d7nkgl_
    automated match to d1e6yb1
    complexed with com, f43, gol, k, so4, tp7

Details for d7nkgb2

PDB Entry: 7nkg (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methermicoccus shengliensis at 1.6-a resolution
PDB Compounds: (B:) Methyl-coenzyme M reductase beta subunit

SCOPe Domain Sequences for d7nkgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nkgb2 a.89.1.1 (B:185-433) automated matches {Methermicoccus shengliensis [TaxId: 1122233]}
gftlrnimanhiaaitqrnamnaaalssileqcgefemgnaigmferhqllglayqglna
nnivyetvkeqgksgtigtvvhsiveraledgvisvdkvapsgykfykandvmlwnayaa
agslaatmvncgaaraaqcvsstllyfndlleketglpgcdygkvqgtavgfsffshsiy
ggggpgvfngnhivtrhsrgfaipcvaaavaldagtqmfspemtsavvgtvygsipefre
piktvaasl

SCOPe Domain Coordinates for d7nkgb2:

Click to download the PDB-style file with coordinates for d7nkgb2.
(The format of our PDB-style files is described here.)

Timeline for d7nkgb2: