Lineage for d1vdeb3 (1vde B:299-415)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34734Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
  4. 34740Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 34753Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
  6. 34758Protein PI-SceI [55615] (1 species)
  7. 34759Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (3 PDB entries)
  8. 34769Domain d1vdeb3: 1vde B:299-415 [40584]
    Other proteins in same PDB: d1vdea1, d1vdeb1

Details for d1vdeb3

PDB Entry: 1vde (more details), 2.4 Å

PDB Description: pi-scei, a homing endonuclease with protein splicing activity

SCOP Domain Sequences for d1vdeb3:

Sequence, based on SEQRES records: (download)

>d1vdeb3 d.95.2.2 (B:299-415) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

Sequence, based on observed residues (ATOM records): (download)

>d1vdeb3 d.95.2.2 (B:299-415) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepatkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1vdeb3:

Click to download the PDB-style file with coordinates for d1vdeb3.
(The format of our PDB-style files is described here.)

Timeline for d1vdeb3: