Lineage for d7njha2 (7njh A:103-173)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of eIF5a homologue (Hex1) [82105] (2 species) 
Species Neurospora crassa [TaxId:367110] [405798] (2 PDB entries) 
Domain d7njha2: 7njh A:103-173 [405799]
Other proteins in same PDB: d7njha1
automated match to d1khia2
Details for d7njha2
PDB Entry: 7njh (more details), 2.5 Å
PDB Description: hex1 (in cellulo) grown inside hare serial crystallography chip
PDB Compounds: (A:) Woronin body major proteinSCOPe Domain Sequences for d7njha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7njha2 b.40.4.5 (A:103-173) C-terminal domain of eIF5a homologue (Hex1) {Neurospora crassa [TaxId: 367110]}
fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr
emavdmkvvhg
SCOPe Domain Coordinates for d7njha2:
Click to download the PDB-style file with coordinates for d7njha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7njha2:
- d7njha2 is new in SCOPe 2.07-stable
- d7njha2 appears in the current release, SCOPe 2.08
View in 3D
