![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein C-terminal domain of eIF5a homologue (Hex1) [82105] (2 species) |
![]() | Species Neurospora crassa [TaxId:367110] [405798] (2 PDB entries) |
![]() | Domain d7njha2: 7njh A:103-173 [405799] Other proteins in same PDB: d7njha1 automated match to d1khia2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 7njh (more details), 2.5 Å
SCOPe Domain Sequences for d7njha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7njha2 b.40.4.5 (A:103-173) C-terminal domain of eIF5a homologue (Hex1) {Neurospora crassa [TaxId: 367110]} fkqyrvldmqdgsivamtetgdvkqnlpvidqsslwnrlqkafesgrgsvrvlvvsdhgr emavdmkvvhg
Timeline for d7njha2: