Lineage for d7njha1 (7njh A:27-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784078Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)
  6. 2784097Protein Woronin body major protein (Hex1) [82070] (2 species)
  7. 2784100Species Neurospora crassa [TaxId:367110] [405796] (2 PDB entries)
  8. 2784102Domain d7njha1: 7njh A:27-102 [405797]
    Other proteins in same PDB: d7njha2
    automated match to d1khia1

Details for d7njha1

PDB Entry: 7njh (more details), 2.5 Å

PDB Description: hex1 (in cellulo) grown inside hare serial crystallography chip
PDB Compounds: (A:) Woronin body major protein

SCOPe Domain Sequences for d7njha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7njha1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Neurospora crassa [TaxId: 367110]}
gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv
snpapsvvvqtmlgpv

SCOPe Domain Coordinates for d7njha1:

Click to download the PDB-style file with coordinates for d7njha1.
(The format of our PDB-style files is described here.)

Timeline for d7njha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7njha2