![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
![]() | Protein Woronin body major protein (Hex1) [82070] (2 species) |
![]() | Species Neurospora crassa [TaxId:367110] [405796] (2 PDB entries) |
![]() | Domain d7njha1: 7njh A:27-102 [405797] Other proteins in same PDB: d7njha2 automated match to d1khia1 |
PDB Entry: 7njh (more details), 2.5 Å
SCOPe Domain Sequences for d7njha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7njha1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Neurospora crassa [TaxId: 367110]} gsasqtvtipchhirlgdililqgrpcqviristsaatgqhrylgvdlftkqlheessfv snpapsvvvqtmlgpv
Timeline for d7njha1: