Lineage for d1ef0b2 (1ef0 B:181-298)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416232Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 416239Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 416280Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 416285Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 416286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (6 PDB entries)
  8. 416295Domain d1ef0b2: 1ef0 B:181-298 [40579]
    Other proteins in same PDB: d1ef0a1, d1ef0b1

Details for d1ef0b2

PDB Entry: 1ef0 (more details), 2.1 Å

PDB Description: crystal structure of pi-scei miniprecursor

SCOP Domain Sequences for d1ef0b2:

Sequence, based on SEQRES records: (download)

>d1ef0b2 d.95.2.2 (B:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkd

Sequence, based on observed residues (ATOM records): (download)

>d1ef0b2 d.95.2.2 (B:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
pilyendhffdymqkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcae
ykdrkepqvaktvnlysglgflkd

SCOP Domain Coordinates for d1ef0b2:

Click to download the PDB-style file with coordinates for d1ef0b2.
(The format of our PDB-style files is described here.)

Timeline for d1ef0b2: