SCOPe 2.08: Domain d1ef0b2: 1ef0 B:181-298

Lineage for d1ef0b2 (1ef0 B:181-298)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
   duplication: contains tandem repeat of this fold

6. Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
   homing endonuclease with protein splicing activity

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
   Uniprot P17255 284-737

8. Domain d1ef0b2: 1ef0 B:181-298 [40579]
   Other proteins in same PDB: d1ef0a1, d1ef0b1
   complexed with zn
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1ef0b2

PDB Entry: 1ef0, 2.1 Å

PDB Description: crystal structure of pi-scei miniprecursor

PDB Compounds: (B:) pi-scei endonuclease

SCOPe Domain Sequences for d1ef0b2:

Sequence, based on SEQRES records:

>d1ef0b2 d.95.2.2 (B:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkd

Sequence, based on observed residues (ATOM records):

>d1ef0b2 d.95.2.2 (B:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcae
ykdrkepqvaktvnlysglgflkd

Timeline for d1ef0b2:

• d1ef0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ef0b2 appears in SCOPe 2.07