SCOPe 2.08: Domain d7n4dc1: 7n4d C:16-84

Lineage for d7n4dc1 (7n4d C:16-84)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (11 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [405722] (1 PDB entry)

8. Domain d7n4dc1: 7n4d C:16-84 [405777]
   Other proteins in same PDB: d7n4da2, d7n4db2, d7n4dc2, d7n4dd2
   automated match to d5hy6a1

Details for d7n4dc1

PDB Entry: 7n4d, 2.45 Å

PDB Description: translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863

PDB Compounds: (C:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d7n4dc1:

Sequence, based on SEQRES records:

>d7n4dc1 b.34.5.0 (C:16-84) automated matches {Naegleria fowleri [TaxId: 5763]}
shtypmqagnlkkggyvvikdkpckitevttsktgkhghakanitgidiftgkkyedvcp
tshnmpvpn

Sequence, based on observed residues (ATOM records):

>d7n4dc1 b.34.5.0 (C:16-84) automated matches {Naegleria fowleri [TaxId: 5763]}
shtypmqagnlkkggyvvikdkpckitevttskanitgidiftgkkyedvcptshnmpvp
n

Timeline for d7n4dc1:

• d7n4dc1 first appeared in SCOPe 2.07