Lineage for d7mqvd2 (7mqv D:186-300)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334637Species Bacillus anthracis [TaxId:1392] [405663] (1 PDB entry)
  8. 2334641Domain d7mqvd2: 7mqv D:186-300 [405767]
    Other proteins in same PDB: d7mqva1, d7mqvb1, d7mqvc1, d7mqvd1
    automated match to d2f1ka1
    complexed with cl, gol, nad

Details for d7mqvd2

PDB Entry: 7mqv (more details), 2.4 Å

PDB Description: crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad
PDB Compounds: (D:) prephenate dehydrogenase

SCOPe Domain Sequences for d7mqvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mqvd2 a.100.1.0 (D:186-300) automated matches {Bacillus anthracis [TaxId: 1392]}
nteehdyvtgivshfphliaaglvkqvekhagdnplihqlaaggfkditriassspkmws
divkqnrehlmvllkewisemedlydtvssgdageiqnyfadakeyrdslpvrkr

SCOPe Domain Coordinates for d7mqvd2:

Click to download the PDB-style file with coordinates for d7mqvd2.
(The format of our PDB-style files is described here.)

Timeline for d7mqvd2: