SCOPe 2.07: Domain d7n7zb1: 7n7z B:4-273

Lineage for d7n7zb1 (7n7z B:4-273)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Syntrophomonas wolfei [TaxId:335541] [405763] (1 PDB entry)

8. Domain d7n7zb1: 7n7z B:4-273 [405764]
   automated match to d4wysa1

Details for d7n7zb1

PDB Entry: 7n7z, 2.02 Å

PDB Description: structure of acetyl-coa acetyltransferase from syntrophomonas wolfei

PDB Compounds: (B:) Acetyl-CoA C-acetyltransferase

SCOPe Domain Sequences for d7n7zb1:

Sequence; same for both SEQRES and ATOM records:

>d7n7zb1 c.95.1.0 (B:4-273) automated matches {Syntrophomonas wolfei [TaxId: 335541]}
einevvvvgmartpigrylgglasvrandlaiiaanaaieragvdpgiideivgatclha
gngslppriigmkvglpvrsgscmvsqncasgmrateiacqnimlgktdislvtavesms
nipyllqqarsgyrmgdgkvqdamlsdglvcqlagghmgmtaeniaekygitreecdala
ltshqnavkavdegifdreivpvvikskkgdkviskdehpirgasletmaklppafkkgg
vvtaanasgindcaaaavfmskkkceelgl

Timeline for d7n7zb1:

• d7n7zb1 is new in SCOPe 2.07-stable
  
• d7n7zb1 appears in the current release, SCOPe 2.08