Lineage for d1dfaa3 (1dfa A:299-415)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332533Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 332540Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 332577Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 332582Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 332583Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (6 PDB entries)
  8. 332589Domain d1dfaa3: 1dfa A:299-415 [40576]
    Other proteins in same PDB: d1dfaa1

Details for d1dfaa3

PDB Entry: 1dfa (more details), 2 Å

PDB Description: crystal structure of pi-scei in c2 space group

SCOP Domain Sequences for d1dfaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfaa3 d.95.2.2 (A:299-415) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1dfaa3:

Click to download the PDB-style file with coordinates for d1dfaa3.
(The format of our PDB-style files is described here.)

Timeline for d1dfaa3: