Lineage for d1dfaa3 (1dfa A:299-415)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82667Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
  4. 82673Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 82690Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
  6. 82695Protein PI-SceI [55615] (1 species)
  7. 82696Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (3 PDB entries)
  8. 82698Domain d1dfaa3: 1dfa A:299-415 [40576]
    Other proteins in same PDB: d1dfaa1

Details for d1dfaa3

PDB Entry: 1dfa (more details), 2 Å

PDB Description: crystal structure of pi-scei in c2 space group

SCOP Domain Sequences for d1dfaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfaa3 d.95.2.2 (A:299-415) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1dfaa3:

Click to download the PDB-style file with coordinates for d1dfaa3.
(The format of our PDB-style files is described here.)

Timeline for d1dfaa3: