Lineage for d1dfaa2 (1dfa A:181-298)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730086Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 730093Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 730148Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 730153Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 730154Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
  8. 730159Domain d1dfaa2: 1dfa A:181-298 [40575]
    Other proteins in same PDB: d1dfaa1

Details for d1dfaa2

PDB Entry: 1dfa (more details), 2 Å

PDB Description: crystal structure of pi-scei in c2 space group
PDB Compounds: (A:) pi-scei endonuclease

SCOP Domain Sequences for d1dfaa2:

Sequence, based on SEQRES records: (download)

>d1dfaa2 d.95.2.2 (A:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkd

Sequence, based on observed residues (ATOM records): (download)

>d1dfaa2 d.95.2.2 (A:181-298) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqltiegpkvlayllglwigdglsdratfsvdsrdtslmervteyaek
lnlcaeykntenplwdaivglgflkd

SCOP Domain Coordinates for d1dfaa2:

Click to download the PDB-style file with coordinates for d1dfaa2.
(The format of our PDB-style files is described here.)

Timeline for d1dfaa2: