Lineage for d1b24a2 (1b24 A:100-179)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966038Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2966049Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2966050Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2966088Protein DNA endonuclease I-dmoI [55612] (1 species)
    duplication: contains tandem repeat of this fold
  7. 2966089Species Desulfurococcus mobilis [TaxId:2274] [55613] (2 PDB entries)
  8. 2966091Domain d1b24a2: 1b24 A:100-179 [40574]

Details for d1b24a2

PDB Entry: 1b24 (more details), 2.2 Å

PDB Description: i-dmoi, intron-encoded endonuclease
PDB Compounds: (A:) protein (I-dmoi)

SCOPe Domain Sequences for d1b24a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b24a2 d.95.2.1 (A:100-179) DNA endonuclease I-dmoI {Desulfurococcus mobilis [TaxId: 2274]}
lfnmreqiafikglyvaegdktlkrlriwnknkalleivsrwlnnlgvrntihlddhrhg
vyvlnislrdrikfvhtils

SCOPe Domain Coordinates for d1b24a2:

Click to download the PDB-style file with coordinates for d1b24a2.
(The format of our PDB-style files is described here.)

Timeline for d1b24a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b24a1