SCOPe 2.07: Domain d7mqvb2: 7mqv B:186-299

Lineage for d7mqvb2 (7mqv B:186-299)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [405663] (1 PDB entry)

8. Domain d7mqvb2: 7mqv B:186-299 [405735]
   Other proteins in same PDB: d7mqva1, d7mqvb1, d7mqvc1, d7mqvd1
   automated match to d2f1ka1
   complexed with cl, gol, nad

Details for d7mqvb2

PDB Entry: 7mqv, 2.4 Å

PDB Description: crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad

PDB Compounds: (B:) prephenate dehydrogenase

SCOPe Domain Sequences for d7mqvb2:

Sequence; same for both SEQRES and ATOM records:

>d7mqvb2 a.100.1.0 (B:186-299) automated matches {Bacillus anthracis [TaxId: 1392]}
nteehdyvtgivshfphliaaglvkqvekhagdnplihqlaaggfkditriassspkmws
divkqnrehlmvllkewisemedlydtvssgdageiqnyfadakeyrdslpvrk

Timeline for d7mqvb2:

• d7mqvb2 is new in SCOPe 2.07-stable
  
• d7mqvb2 appears in the current release, SCOPe 2.08