Lineage for d1bp7c_ (1bp7 C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82667Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
  4. 82673Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 82674Family d.95.2.1: Group I mobile intron endonuclease [55609] (2 proteins)
  6. 82675Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 82676Species Chlamydomonas reinhardtii [TaxId:3055] [55611] (4 PDB entries)
  8. 82683Domain d1bp7c_: 1bp7 C: [40570]

Details for d1bp7c_

PDB Entry: 1bp7 (more details), 3 Å

PDB Description: group i mobile intron endonuclease i-crei complexed with homing site dna

SCOP Domain Sequences for d1bp7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bp7c_ d.95.2.1 (C:) DNA endonuclease I-CreI {Chlamydomonas reinhardtii}
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOP Domain Coordinates for d1bp7c_:

Click to download the PDB-style file with coordinates for d1bp7c_.
(The format of our PDB-style files is described here.)

Timeline for d1bp7c_: