Lineage for d7mx5b2 (7mx5 B:157-426)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417861Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families) (S)
  5. 2417889Family b.68.4.0: automated matches [405625] (1 protein)
    not a true family
  6. 2417890Protein automated matches [405626] (1 species)
    not a true protein
  7. 2417891Species Acinetobacter baumannii [TaxId:470] [405627] (1 PDB entry)
  8. 2417893Domain d7mx5b2: 7mx5 B:157-426 [405698]
    Other proteins in same PDB: d7mx5a1, d7mx5a3, d7mx5b1
    automated match to d4pwza2

Details for d7mx5b2

PDB Entry: 7mx5 (more details), 2.42 Å

PDB Description: crystal structure of tolb from acinetobacter baumannii
PDB Compounds: (B:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d7mx5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mx5b2 b.68.4.0 (B:157-426) automated matches {Acinetobacter baumannii [TaxId: 470]}
dfsgriayvlrnpatpaerytlqiadtdgeqpktvlssrdpilspawtpdakkiayvsfe
tkrpaiylqdlstgtrevitsfkglngapsfspdgksmlftasmngnpeiyqmdlstrqv
krmtndsgidtearytpdgkafiftsdrggspqiyrydfgngsvkrltfkgsfnargtls
adgkkialvhrpsgsnykvaiqdintgivniltptsldespsfspngqmvvyatregnrg
llsimstdgrfrmnlpseqgevrepawapk

SCOPe Domain Coordinates for d7mx5b2:

Click to download the PDB-style file with coordinates for d7mx5b2.
(The format of our PDB-style files is described here.)

Timeline for d7mx5b2: