SCOPe 2.07: Domain d7mx5b1: 7mx5 B:28-156

Lineage for d7mx5b1 (7mx5 B:28-156)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families)

5. Family c.51.2.0: automated matches [232575] (1 protein)
   not a true family

6. Protein automated matches [232576] (4 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [405623] (1 PDB entry)

8. Domain d7mx5b1: 7mx5 B:28-156 [405697]
   Other proteins in same PDB: d7mx5a2, d7mx5a3, d7mx5b2
   automated match to d4pwza1

Details for d7mx5b1

PDB Entry: 7mx5, 2.42 Å

PDB Description: crystal structure of tolb from acinetobacter baumannii

PDB Compounds: (B:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d7mx5b1:

Sequence; same for both SEQRES and ATOM records:

>d7mx5b1 c.51.2.0 (B:28-156) automated matches {Acinetobacter baumannii [TaxId: 470]}
qlhleiakapdqapkiaivpfnndnglypivetdlnrsgrftsssknlpanaainqiqas
dwqaagipyvvtgqikqtadgfevhyqlydvqkqqyllnellnvpasrirqaghmvsdai
yqaltgipg

Timeline for d7mx5b1:

• d7mx5b1 is new in SCOPe 2.07-stable
  
• d7mx5b1 appears in the current release, SCOPe 2.08