| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (3 PDB entries) |
| Domain d7mqvc1: 7mqv C:7-185 [405688] Other proteins in same PDB: d7mqva2, d7mqvb2, d7mqvc2, d7mqvd2 automated match to d2f1ka2 complexed with cl, gol, nad |
PDB Entry: 7mqv (more details), 2.4 Å
SCOPe Domain Sequences for d7mqvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mqvc1 c.2.1.0 (C:7-185) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
slemrqmrkkvvligtgliggslalaikkdhdvtitgydifqeqverakelhvvdeiavd
lqhaceeahlivfaspveetkkllhklasfhlredvivtdvgstkgsimneaealfskei
sfigghpmagshktgvesakahlfenafyiltpmhhvpnehveelkdwlkgtgshflvl
Timeline for d7mqvc1: