Lineage for d1bp7a_ (1bp7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572655Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2572666Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2572667Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2572674Protein DNA endonuclease I-CreI [55610] (1 species)
  7. 2572675Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [55611] (11 PDB entries)
    Uniprot P05725 2-154 ! Uniprot P05725
  8. 2572696Domain d1bp7a_: 1bp7 A: [40568]
    protein/DNA complex; complexed with ca

Details for d1bp7a_

PDB Entry: 1bp7 (more details), 3 Å

PDB Description: group i mobile intron endonuclease i-crei complexed with homing site dna
PDB Compounds: (A:) protein (I-crei)

SCOPe Domain Sequences for d1bp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bp7a_ d.95.2.1 (A:) DNA endonuclease I-CreI {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOPe Domain Coordinates for d1bp7a_:

Click to download the PDB-style file with coordinates for d1bp7a_.
(The format of our PDB-style files is described here.)

Timeline for d1bp7a_: