Lineage for d1iba__ (1iba -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) 
Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) 
Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein) Protein Glucose permease domain IIB [55606] (1 species) Species Escherichia coli [TaxId:562] [55607] (1 PDB entry) 
Domain d1iba__: 1iba - [40567]
Details for d1iba__
PDB Entry: 1iba (more details)
PDB Description: glucose permease (domain iib), nmr, 11 structures
SCOP Domain Sequences for d1iba__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iba__ d.95.1.1 (-) Glucose permease domain IIB {Escherichia coli}
mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
tksdnlktemdeyirnfg
SCOP Domain Coordinates for d1iba__:
Click to download the PDB-style file with coordinates for d1iba__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iba__:
- d1iba__ first appeared (with stable ids) in SCOP 1.55
- d1iba__ appears in SCOP 1.59
- d1iba__ appears in the current release, SCOPe 2.08, called d1ibaa1
View in 3D