Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Bacillus anthracis [TaxId:1392] [405663] (1 PDB entry) |
Domain d7mqva2: 7mqv A:186-297 [405664] Other proteins in same PDB: d7mqva1, d7mqvb1, d7mqvc1, d7mqvd1 automated match to d2f1ka1 complexed with cl, gol, nad |
PDB Entry: 7mqv (more details), 2.4 Å
SCOPe Domain Sequences for d7mqva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mqva2 a.100.1.0 (A:186-297) automated matches {Bacillus anthracis [TaxId: 1392]} nteehdyvtgivshfphliaaglvkqvekhagdnplihqlaaggfkditriassspkmws divkqnrehlmvllkewisemedlydtvssgdageiqnyfadakeyrdslpv
Timeline for d7mqva2: