Lineage for d7mqva1 (7mqv A:4-185)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454291Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (3 PDB entries)
  8. 2454293Domain d7mqva1: 7mqv A:4-185 [405662]
    Other proteins in same PDB: d7mqva2, d7mqvb2, d7mqvc2, d7mqvd2
    automated match to d2f1ka2
    complexed with cl, gol, nad

Details for d7mqva1

PDB Entry: 7mqv (more details), 2.4 Å

PDB Description: crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad
PDB Compounds: (A:) prephenate dehydrogenase

SCOPe Domain Sequences for d7mqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mqva1 c.2.1.0 (A:4-185) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kkeslemrqmrkkvvligtgliggslalaikkdhdvtitgydifqeqverakelhvvdei
avdlqhaceeahlivfaspveetkkllhklasfhlredvivtdvgstkgsimneaealfs
keisfigghpmagshktgvesakahlfenafyiltpmhhvpnehveelkdwlkgtgshfl
vl

SCOPe Domain Coordinates for d7mqva1:

Click to download the PDB-style file with coordinates for d7mqva1.
(The format of our PDB-style files is described here.)

Timeline for d7mqva1: