SCOPe 2.08: Domain d7mqva1: 7mqv A:4-185

Lineage for d7mqva1 (7mqv A:4-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (3 PDB entries)

8. Domain d7mqva1: 7mqv A:4-185 [405662]
   Other proteins in same PDB: d7mqva2, d7mqvb2, d7mqvc2, d7mqvd2
   automated match to d2f1ka2
   complexed with cl, gol, nad

Details for d7mqva1

PDB Entry: 7mqv, 2.4 Å

PDB Description: crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad

PDB Compounds: (A:) prephenate dehydrogenase

SCOPe Domain Sequences for d7mqva1:

Sequence; same for both SEQRES and ATOM records:

>d7mqva1 c.2.1.0 (A:4-185) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kkeslemrqmrkkvvligtgliggslalaikkdhdvtitgydifqeqverakelhvvdei
avdlqhaceeahlivfaspveetkkllhklasfhlredvivtdvgstkgsimneaealfs
keisfigghpmagshktgvesakahlfenafyiltpmhhvpnehveelkdwlkgtgshfl
vl

Timeline for d7mqva1:

• d7mqva1 first appeared in SCOPe 2.07