SCOPe 2.03: Domain d1qr5a_: 1qr5 A:

Lineage for d1qr5a_ (1qr5 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Staphylococcus carnosus [TaxId:1281] [55602] (1 PDB entry)

8. Domain d1qr5a_: 1qr5 A: [40566]

Details for d1qr5a_

PDB Entry: 1qr5

PDB Description: solution structure of histidine containing protein (hpr) from staphylococcus carnosus

PDB Compounds: (A:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1qr5a_:

Sequence; same for both SEQRES and ATOM records:

>d1qr5a_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Staphylococcus carnosus [TaxId: 1281]}
meqqsytiidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdeadaiqaitdvlskeglte

Timeline for d1qr5a_:

• d1qr5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qr5a_ appears in SCOPe 2.02
  
• d1qr5a_ appears in SCOPe 2.04
  
• d1qr5a_ appears in the current release, SCOPe 2.08