Lineage for d7ms5b_ (7ms5 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037640Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 3037647Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)
  7. 3037648Species Human (Homo sapiens) [TaxId:9606] [161208] (9 PDB entries)
    Uniprot P45974 169-285
  8. 3037659Domain d7ms5b_: 7ms5 B: [405652]
    automated match to d2g45a_
    complexed with ca, edo, zn, zog

Details for d7ms5b_

PDB Entry: 7ms5 (more details), 1.98 Å

PDB Description: structure of usp5 zinc-finger ubiquitin binding domain co-crystallized with 4-(4-(4-(3,4-difluoro-phenyl)-piperidin-1-ylsulfonyl)-phenyl)-4- oxo-butanoic acid
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d7ms5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ms5b_ g.44.1.5 (B:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt

SCOPe Domain Coordinates for d7ms5b_:

Click to download the PDB-style file with coordinates for d7ms5b_.
(The format of our PDB-style files is described here.)

Timeline for d7ms5b_: