Lineage for d1zer__ (1zer -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Staphylococcus aureus [TaxId:1280] [55601] (1 PDB entry) 
Domain d1zer__: 1zer - [40565]
Details for d1zer__
PDB Entry: 1zer (more details)
PDB Description: the solution structure of the histidine-containing protein (hpr) from staphylococcus aureus as determined by two-dimensional 1h-nmr spectroscopy
SCOP Domain Sequences for d1zer__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zer__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Staphylococcus aureus}
meqnsyviidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
itiyadgsdesdaiqaisdvlskeglt
SCOP Domain Coordinates for d1zer__:
Click to download the PDB-style file with coordinates for d1zer__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zer__:
- d1zer__ first appeared (with stable ids) in SCOP 1.55
- d1zer__ appears in SCOP 1.59
- d1zer__ last appears in SCOP 1.63
View in 3D