Lineage for d1pcha_ (1pch A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572528Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2572529Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2572530Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2572547Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2572612Species Mycoplasma capricolum [TaxId:2095] [55600] (1 PDB entry)
  8. 2572613Domain d1pcha_: 1pch A: [40564]
    CASP1
    complexed with so4

Details for d1pcha_

PDB Entry: 1pch (more details), 1.8 Å

PDB Description: structural evidence for the evolutionary divergence of mycoplasma from gram-positive bacteria: the histidine-containing phosphocarrier protein
PDB Compounds: (A:) phosphocarrier protein

SCOPe Domain Sequences for d1pcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Mycoplasma capricolum [TaxId: 2095]}
akfsaiitdkvglharpasvlakeaskfssnitiianekqgnlksimnvmamaiktgtei
tiqadgndadqaiqaikqtmidtaliqg

SCOPe Domain Coordinates for d1pcha_:

Click to download the PDB-style file with coordinates for d1pcha_.
(The format of our PDB-style files is described here.)

Timeline for d1pcha_: