Lineage for d1pch__ (1pch -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Mycoplasma capricolum [TaxId:2095] [55600] (1 PDB entry) 
Domain d1pch__: 1pch - [40564]
Details for d1pch__
PDB Entry: 1pch (more details), 1.8 Å
PDB Description: structural evidence for the evolutionary divergence of mycoplasma from gram-positive bacteria: the histidine-containing phosphocarrier protein
SCOP Domain Sequences for d1pch__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pch__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Mycoplasma capricolum}
akfsaiitdkvglharpasvlakeaskfssnitiianekqgnlksimnvmamaiktgtei
tiqadgndadqaiqaikqtmidtaliqg
SCOP Domain Coordinates for d1pch__:
Click to download the PDB-style file with coordinates for d1pch__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pch__:
- d1pch__ appears in SCOP 1.57
- d1pch__ appears in the current release, SCOPe 2.08, called d1pcha_
View in 3D