Lineage for d1pch__ (1pch -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34701Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 34702Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 34703Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 34704Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 34728Species Mycoplasma capricolum [TaxId:2095] [55600] (1 PDB entry)
  8. 34729Domain d1pch__: 1pch - [40564]

Details for d1pch__

PDB Entry: 1pch (more details), 1.8 Å

PDB Description: structural evidence for the evolutionary divergence of mycoplasma from gram-positive bacteria: the histidine-containing phosphocarrier protein

SCOP Domain Sequences for d1pch__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pch__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Mycoplasma capricolum}
akfsaiitdkvglharpasvlakeaskfssnitiianekqgnlksimnvmamaiktgtei
tiqadgndadqaiqaikqtmidtaliqg

SCOP Domain Coordinates for d1pch__:

Click to download the PDB-style file with coordinates for d1pch__.
(The format of our PDB-style files is described here.)

Timeline for d1pch__: