| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
| Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
| Species Escherichia coli [TaxId:562] [55599] (18 PDB entries) |
| Domain d1ggrb_: 1ggr B: [40563] Other proteins in same PDB: d1ggra_ complexed with po3 |
PDB Entry: 1ggr (more details)
SCOPe Domain Sequences for d1ggrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggrb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
Timeline for d1ggrb_: