SCOP 1.73: Domain d1ggrb_: 1ggr B:

Lineage for d1ggrb_ (1ggr B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Escherichia coli [TaxId:562] [55599] (13 PDB entries)

8. Domain d1ggrb_: 1ggr B: [40563]
   Other proteins in same PDB: d1ggra_
   complexed with po3

Details for d1ggrb_

PDB Entry: 1ggr

PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (B:) Phosphocarrier protein HPr

SCOP Domain Sequences for d1ggrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ggrb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1ggrb_:

• d1ggrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ggrb_ appears in SCOP 1.71
  
• d1ggrb_ appears in SCOP 1.75
  
• d1ggrb_ appears in the current release, SCOPe 2.08