Lineage for d1ggrb_ (1ggr B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82634Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 82635Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 82636Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 82637Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 82649Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 82659Domain d1ggrb_: 1ggr B: [40563]
    Other proteins in same PDB: d1ggra_

Details for d1ggrb_

PDB Entry: 1ggr (more details)

PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d1ggrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggrb_ d.94.1.1 (B:) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d1ggrb_:

Click to download the PDB-style file with coordinates for d1ggrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ggrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ggra_