SCOPe 2.07: Domain d7mx5a2: 7mx5 A:157-426

Lineage for d7mx5a2 (7mx5 A:157-426)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.4: TolB, C-terminal domain [50960] (2 families)

5. Family b.68.4.0: automated matches [405625] (1 protein)
   not a true family

6. Protein automated matches [405626] (1 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [405627] (1 PDB entry)

8. Domain d7mx5a2: 7mx5 A:157-426 [405628]
   Other proteins in same PDB: d7mx5a1, d7mx5a3, d7mx5b1
   automated match to d4pwza2

Details for d7mx5a2

PDB Entry: 7mx5, 2.42 Å

PDB Description: crystal structure of tolb from acinetobacter baumannii

PDB Compounds: (A:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d7mx5a2:

Sequence; same for both SEQRES and ATOM records:

>d7mx5a2 b.68.4.0 (A:157-426) automated matches {Acinetobacter baumannii [TaxId: 470]}
dfsgriayvlrnpatpaerytlqiadtdgeqpktvlssrdpilspawtpdakkiayvsfe
tkrpaiylqdlstgtrevitsfkglngapsfspdgksmlftasmngnpeiyqmdlstrqv
krmtndsgidtearytpdgkafiftsdrggspqiyrydfgngsvkrltfkgsfnargtls
adgkkialvhrpsgsnykvaiqdintgivniltptsldespsfspngqmvvyatregnrg
llsimstdgrfrmnlpseqgevrepawapk

Timeline for d7mx5a2:

• d7mx5a2 is new in SCOPe 2.07-stable
  
• d7mx5a2 appears in the current release, SCOPe 2.08