Lineage for d7mx5a1 (7mx5 A:28-156)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489935Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2489949Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 2489950Protein automated matches [232576] (4 species)
    not a true protein
  7. 2489951Species Acinetobacter baumannii [TaxId:470] [405623] (1 PDB entry)
  8. 2489952Domain d7mx5a1: 7mx5 A:28-156 [405624]
    Other proteins in same PDB: d7mx5a2, d7mx5a3, d7mx5b2
    automated match to d4pwza1

Details for d7mx5a1

PDB Entry: 7mx5 (more details), 2.42 Å

PDB Description: crystal structure of tolb from acinetobacter baumannii
PDB Compounds: (A:) Tol-Pal system protein TolB

SCOPe Domain Sequences for d7mx5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mx5a1 c.51.2.0 (A:28-156) automated matches {Acinetobacter baumannii [TaxId: 470]}
qlhleiakapdqapkiaivpfnndnglypivetdlnrsgrftsssknlpanaainqiqas
dwqaagipyvvtgqikqtadgfevhyqlydvqkqqyllnellnvpasrirqaghmvsdai
yqaltgipg

SCOPe Domain Coordinates for d7mx5a1:

Click to download the PDB-style file with coordinates for d7mx5a1.
(The format of our PDB-style files is described here.)

Timeline for d7mx5a1: