![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) ![]() |
![]() | Family c.51.2.0: automated matches [232575] (1 protein) not a true family |
![]() | Protein automated matches [232576] (4 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [405623] (1 PDB entry) |
![]() | Domain d7mx5a1: 7mx5 A:28-156 [405624] Other proteins in same PDB: d7mx5a2, d7mx5a3, d7mx5b2 automated match to d4pwza1 |
PDB Entry: 7mx5 (more details), 2.42 Å
SCOPe Domain Sequences for d7mx5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mx5a1 c.51.2.0 (A:28-156) automated matches {Acinetobacter baumannii [TaxId: 470]} qlhleiakapdqapkiaivpfnndnglypivetdlnrsgrftsssknlpanaainqiqas dwqaagipyvvtgqikqtadgfevhyqlydvqkqqyllnellnvpasrirqaghmvsdai yqaltgipg
Timeline for d7mx5a1: