SCOP 1.75: Domain d1pfha_: 1pfh A:

Lineage for d1pfha_ (1pfh A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Escherichia coli [TaxId:562] [55599] (13 PDB entries)

8. Domain d1pfha_: 1pfh A: [40561]
   complexed with phs

Details for d1pfha_

PDB Entry: 1pfh

PDB Description: the phosphorylated form of the histidine-containing phosphocarrier protein hpr

PDB Compounds: (A:) phospho-hpr

SCOP Domain Sequences for d1pfha_:

Sequence; same for both SEQRES and ATOM records:

>d1pfha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1pfha_:

• d1pfha_ first appeared (with stable ids) in SCOP 1.55, called d1pfh__
  
• d1pfha_ appears in SCOP 1.73
  
• d1pfha_ appears in SCOPe 2.01
  
• d1pfha_ appears in the current release, SCOPe 2.08