Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (1 family) |
Family d.94.1.1: HPr-like [55595] (2 proteins) |
Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species) |
Species Escherichia coli [TaxId:562] [55599] (13 PDB entries) |
Domain d1pfha_: 1pfh A: [40561] complexed with phs |
PDB Entry: 1pfh (more details)
SCOP Domain Sequences for d1pfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfha_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]} mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv vtisaegedeqkavehlvklmaele
Timeline for d1pfha_: