Lineage for d1pfh__ (1pfh -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily) Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) 
Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein) Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species) 
Species Escherichia coli [TaxId:562] [55599] (11 PDB entries) 
Domain d1pfh__: 1pfh - [40561]
Details for d1pfh__
PDB Entry: 1pfh (more details)
PDB Description: the phosphorylated form of the histidine-containing phosphocarrier protein hpr
SCOP Domain Sequences for d1pfh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfh__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele
SCOP Domain Coordinates for d1pfh__:
Click to download the PDB-style file with coordinates for d1pfh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pfh__:
- d1pfh__ first appeared (with stable ids) in SCOP 1.55
- d1pfh__ appears in SCOP 1.59
- d1pfh__ appears in the current release, SCOPe 2.08, called d1pfha_
View in 3D